PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV57882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 383aa    MW: 43729.7 Da    PI: 8.7676
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV57882.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.73.5e-2289148357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t++ql++Leel+++  r+psa++++++A+kl    +++ ++V++WFqN++a+e++
  KZV57882.1  89 PRWNPTPDQLQALEELYRRgIRTPSAQQIQQIAAKLrrfgKIEGKNVFYWFQNHKARERQ 148
                 8*****************99**************************************97 PP

2Wus_type_Homeobox112.62e-3688150365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q++ Leely++G+rtP++++iq+i+a+L+++Gkie+kNVfyWFQN+kaRerqk+
         KZV57882.1  88 SPRWNPTPDQLQALEELYRRGIRTPSAQQIQQIAAKLRRFGKIEGKNVFYWFQNHKARERQKK 150
                        68***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.3E-686153IPR001356Homeobox domain
SuperFamilySSF466897.01E-1388154IPR009057Homeodomain-like
CDDcd000868.89E-889150No hitNo description
PfamPF000467.9E-2089148IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-989148IPR009057Homeodomain-like
PROSITE profilePS5007111.3794149IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MWMVDCDDQH VKDIKVSIGR TLQPLTPRAI TAAATMKCAY STLPGPCCTN HPNVIGWSQP  60
IINLYTMLQG CERDYGMRRE MNRVPLVSPR WNPTPDQLQA LEELYRRGIR TPSAQQIQQI  120
AAKLRRFGKI EGKNVFYWFQ NHKARERQKK RRQLELHAGK KLHHADVMFE AQLQSGYVIL  180
PSQHVCNLIF VSEKTPRSSL ELVSWKFIFM GSIFVSEKNR SHGCSRENID LGHVKKQSST  240
FSNSSTPSQD SVSLHAPVVA TEWTKLDQRE LQQQAKNEQT CWQLDLSSSM PSNKSDDIIN  300
KYAVPENNPD QENEKPLNPP NISLLMFPAH DSGIKENRTL LLFPVKSHGS SALCTAEEEI  360
NDGSSTRTRF TPSEYYEFLP MKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.14e-35WUSCHEL related homeobox 1